biomass

    0.2.0 • Public • Published

    biomass Build Status

    Generate bio data from sunlight and alphabets

    NPM

    Install

    Install biomass with npm:

    $ npm install biomass

    If you are using biomass with Node.js, you can require the module:

    var biomass = require('biomass');

    Alternatively, just include biomass.min.js via a <script/> in your page.

    <script src="../biomass.min.js"></script>

    Usage

    // Sequence functions will return between 10 and 100 characters if a length is not specified:
    biomass.dna();
    => 'CATAGGGACCAAGCTCTGGGGAGCAACCCATAAGCACGACAATCGCGATAATACGTAGTACGCCGCTTGGTTCGTGCCTTCCCGCGCG'
    biomass.rna();
    => 'GAGUAGGCUAGGCAUAGC'
    biomass.dna({length: 15});
    => 'TTTTGTATGCGTACG'
    biomass.rna({length: 3});
    => 'UAC'
    biomass.rna({length: 3, case: "lower"});
    => 'uga'
    biomass.protein();
    => 'YHAVPVPEEYWRWNTEDVCNTFECMEVINAYRNWFFWLQEFMGPERLPAHMYCHDASAPMMFQGCWDHEEKDMGCVGP'
    biomass.protein({ambiguous: true});
    => 'FAFNDMLCXVYPRVQATLCLNNAPDIPSMGPKXFRRFLCYPFC'

    Changelog

    v0.2.0 - September 23, 2014 - Is tiis messaje a libtle bot fuzxy?

    • Added ambiguity to biomass.dna, biomass.rna, and biomass.protein functions. Follows IUPAC notation for ambiguous nucleotides and X unknown amino acids.

    v0.1.0 - August 10, 2014 - Eat your protein bars...

    • Added biomass.protein for generating random amino acid sequences.
    • Fix version number to adequately reflect updates

    v0.0.2 - July 26, 2014 - Uptown, downtown...

    • Now biomass.dna and biomass.rna are case aware with a default response of uppercase letters.

    v0.0.1 - July 21, 2014 - Dawn

    Initial release

    • Added biomass.dna for generating random DNA sequences.
    • Added biomass.rna for generating random RNA sequences.

    Contacts

    Alan Rice <alanmrice@gmail.com> @alanmrice

    License

    biomass is licensed under the MIT license.
    Check ChooseALicense.com for details.

    Install

    npm i biomass

    DownloadsWeekly Downloads

    0

    Version

    0.2.0

    License

    MIT

    Last publish

    Collaborators

    • alanrice