node package manager
Easy sharing. Manage teams and permissions with one click. Create a free org »

biomass

biomass Build Status

Generate bio data from sunlight and alphabets

NPM

Install

Install biomass with npm:

$ npm install biomass

If you are using biomass with Node.js, you can require the module:

var biomass = require('biomass');

Alternatively, just include biomass.min.js via a <script/> in your page.

<script src="../biomass.min.js"></script>

Usage

// Sequence functions will return between 10 and 100 characters if a length is not specified: 
biomass.dna();
=> 'CATAGGGACCAAGCTCTGGGGAGCAACCCATAAGCACGACAATCGCGATAATACGTAGTACGCCGCTTGGTTCGTGCCTTCCCGCGCG'
biomass.rna();
=> 'GAGUAGGCUAGGCAUAGC'
biomass.dna({length: 15});
=> 'TTTTGTATGCGTACG'
biomass.rna({length: 3});
=> 'UAC'
biomass.rna({length: 3, case: "lower"});
=> 'uga'
biomass.protein();
=> 'YHAVPVPEEYWRWNTEDVCNTFECMEVINAYRNWFFWLQEFMGPERLPAHMYCHDASAPMMFQGCWDHEEKDMGCVGP'
biomass.protein({ambiguous: true});
=> 'FAFNDMLCXVYPRVQATLCLNNAPDIPSMGPKXFRRFLCYPFC'

Changelog

v0.2.0 - September 23, 2014 - Is tiis messaje a libtle bot fuzxy?

  • Added ambiguity to biomass.dna, biomass.rna, and biomass.protein functions. Follows IUPAC notation for ambiguous nucleotides and X unknown amino acids.

v0.1.0 - August 10, 2014 - Eat your protein bars...

  • Added biomass.protein for generating random amino acid sequences.
  • Fix version number to adequately reflect updates

v0.0.2 - July 26, 2014 - Uptown, downtown...

  • Now biomass.dna and biomass.rna are case aware with a default response of uppercase letters.

v0.0.1 - July 21, 2014 - Dawn

Initial release

  • Added biomass.dna for generating random DNA sequences.
  • Added biomass.rna for generating random RNA sequences.

Contacts

Alan Rice <alanmrice@gmail.com> @alanmrice

License

biomass is licensed under the MIT license.
Check ChooseALicense.com for details.